Lineage for d1oe3a2 (1oe3 A:160-336)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Alcaligenes xylosoxidans [TaxId:85698] [419329] (24 PDB entries)
    Uniprot O68601
  8. Domain d1oe3a2: 1oe3 A:160-336 [103904]
    Other proteins in same PDB: d1oe3a1
    complexed with cu, pg4
    has additional insertions and/or extensions that are not grouped together

Details for d1oe3a2

PDB Entry: 1oe3 (more details), 1.1500000000000001 Å

PDB Description: atomic resolution structure of 'half apo' nir
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d1oe3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oe3a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR, C-terminal domain {Alcaligenes xylosoxidans [TaxId: 85698]}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr

SCOPe Domain Coordinates for d1oe3a2 are not available.

Timeline for d1oe3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oe3a1