Lineage for d1ob2a3 (1ob2 A:1-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867148Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2867155Species Escherichia coli [TaxId:562] [52627] (11 PDB entries)
    Uniprot P02990
  8. 2867173Domain d1ob2a3: 1ob2 A:1-204 [103902]
    Other proteins in same PDB: d1ob2a1, d1ob2a2
    protein/RNA complex; complexed with gnp, kir, mg

Details for d1ob2a3

PDB Entry: 1ob2 (more details), 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ob2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob2a3 c.37.1.8 (A:1-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
akekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
daeweakilelagfldsyipeper

SCOPe Domain Coordinates for d1ob2a3:

Click to download the PDB-style file with coordinates for d1ob2a3.
(The format of our PDB-style files is described here.)

Timeline for d1ob2a3: