Lineage for d1ob2a2 (1ob2 A:297-393)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1792475Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1792476Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1792477Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1792505Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1792512Species Escherichia coli [TaxId:562] [50468] (8 PDB entries)
    Uniprot P02990
  8. 1792524Domain d1ob2a2: 1ob2 A:297-393 [103901]
    Other proteins in same PDB: d1ob2a1, d1ob2a3
    protein/RNA complex; complexed with gnp, kir, mg, suc

Details for d1ob2a2

PDB Entry: 1ob2 (more details), 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ob2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob2a2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d1ob2a2:

Click to download the PDB-style file with coordinates for d1ob2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ob2a2: