SCOP 1.75: Domain d1ob2a2: 1ob2 A:297-393

Lineage for d1ob2a2 (1ob2 A:297-393)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Escherichia coli [TaxId:562] [50468] (7 PDB entries)
   Uniprot P02990

8. Domain d1ob2a2: 1ob2 A:297-393 [103901]
   Other proteins in same PDB: d1ob2a1, d1ob2a3
   complexed with 2mg, 5mc, 7mg, gnp, h2u, kir, m2g, mad, mg, omc, omg, pha, psu, suc, yg

Details for d1ob2a2

PDB Entry: 1ob2, 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna

PDB Compounds: (A:) elongation factor tu

SCOP Domain Sequences for d1ob2a2:

Sequence; same for both SEQRES and ATOM records:

>d1ob2a2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

Timeline for d1ob2a2:

• d1ob2a2 first appeared in SCOP 1.69
  
• d1ob2a2 appears in SCOP 1.73
  
• d1ob2a2 appears in SCOPe 2.01
  
• d1ob2a2 appears in the current release, SCOPe 2.08