Lineage for d1o8cc1 (1o8c C:2-115,C:293-323)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558383Protein Hypothetical protein YhdH [101706] (1 species)
  7. 558384Species Escherichia coli [TaxId:562] [101707] (2 PDB entries)
  8. 558388Domain d1o8cc1: 1o8c C:2-115,C:293-323 [103896]
    Other proteins in same PDB: d1o8ca2, d1o8cb2, d1o8cc2, d1o8cd2

Details for d1o8cc1

PDB Entry: 1o8c (more details), 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph

SCOP Domain Sequences for d1o8cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8cc1 b.35.1.2 (C:2-115,C:293-323) Hypothetical protein YhdH {Escherichia coli}
qallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmip
gidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgXqaake
islseapnfaeaiinnqiqgrtlvkv

SCOP Domain Coordinates for d1o8cc1:

Click to download the PDB-style file with coordinates for d1o8cc1.
(The format of our PDB-style files is described here.)

Timeline for d1o8cc1: