SCOPe 2.08: Domain d1o8cc1: 1o8c C:2-115,C:293-323

Lineage for d1o8cc1 (1o8c C:2-115,C:293-323)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Hypothetical protein YhdH [101706] (1 species)

7. Species Escherichia coli [TaxId:562] [101707] (2 PDB entries)
   Uniprot P26646

8. Domain d1o8cc1: 1o8c C:2-115,C:293-323 [103896]
   Other proteins in same PDB: d1o8ca4, d1o8ca5, d1o8cb4, d1o8cb5, d1o8cc3, d1o8cd4, d1o8cd5
   Structural genomics target
   complexed with ndp

Details for d1o8cc1

PDB Entry: 1o8c, 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph

PDB Compounds: (C:) yhdh

SCOPe Domain Sequences for d1o8cc1:

Sequence; same for both SEQRES and ATOM records:

>d1o8cc1 b.35.1.2 (C:2-115,C:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]}
qallleqqdgktlasvqtldesrlpegdvtvdvhwsslnykdalaitgkgkiirnfpmip
gidfagtvrtsedprfhagqevlltgwgvgenhwgglaeqarvkgdwlvampqgXqaake
islseapnfaeaiinnqiqgrtlvkv

Timeline for d1o8cc1:

• d1o8cc1 first appeared in SCOP 1.69
  
• d1o8cc1 appears in SCOPe 2.07