Lineage for d1o8cb2 (1o8c B:116-192)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574389Protein Hypothetical protein YhdH [102126] (1 species)
  7. 574390Species Escherichia coli [TaxId:562] [102127] (2 PDB entries)
  8. 574393Domain d1o8cb2: 1o8c B:116-192 [103895]
    Other proteins in same PDB: d1o8ca1, d1o8cb1, d1o8cc1, d1o8cd1

Details for d1o8cb2

PDB Entry: 1o8c (more details), 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph

SCOP Domain Sequences for d1o8cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8cb2 c.2.1.1 (B:116-192) Hypothetical protein YhdH {Escherichia coli}
ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv
avsgrestheylkslga

SCOP Domain Coordinates for d1o8cb2:

Click to download the PDB-style file with coordinates for d1o8cb2.
(The format of our PDB-style files is described here.)

Timeline for d1o8cb2: