SCOP 1.71: Domain d1o8ca2: 1o8c A:116-192

Lineage for d1o8ca2 (1o8c A:116-192)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Hypothetical protein YhdH [102126] (1 species)

7. Species Escherichia coli [TaxId:562] [102127] (2 PDB entries)

8. Domain d1o8ca2: 1o8c A:116-192 [103893]
   Other proteins in same PDB: d1o8ca1, d1o8cb1, d1o8cc1, d1o8cd1

Details for d1o8ca2

PDB Entry: 1o8c, 2.6 Å

PDB Description: crystal structure of e. coli k-12 yhdh with bound nadph

SCOP Domain Sequences for d1o8ca2:

Sequence; same for both SEQRES and ATOM records:

>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli}
ldarkamiigtagftamlcvmaledagvrpqdgeivvtgasggvgstavallhklgyqvv
avsgrestheylkslga

Timeline for d1o8ca2:

• d1o8ca2 first appeared in SCOP 1.69
  
• d1o8ca2 appears in SCOP 1.73
  
• d1o8ca2 last appears in SCOPe 2.02