Lineage for d1o5g.1 (1o5g L:,H:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670861Protein Thrombin [50531] (2 species)
  7. 670908Species Human (Homo sapiens) [TaxId:9606] [50532] (163 PDB entries)
  8. 670931Domain d1o5g.1: 1o5g L:,H: [103889]
    complexed with ca, cr9, na

Details for d1o5g.1

PDB Entry: 1o5g (more details), 1.75 Å

PDB Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
PDB Compounds: (H:) Prothrombin, (L:) Prothrombin

SCOP Domain Sequences for d1o5g.1:

Sequence, based on SEQRES records: (download)

>g1o5g.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqel
lcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyi
hprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlke
twtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsg
gpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Sequence, based on observed residues (ATOM records): (download)

>g1o5g.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyiXivegsdaeigmspwqvmlfrkspqel
lcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyi
hprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlke
tgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmks
pfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOP Domain Coordinates for d1o5g.1:

Click to download the PDB-style file with coordinates for d1o5g.1.
(The format of our PDB-style files is described here.)

Timeline for d1o5g.1: