Lineage for d1o5el_ (1o5e L:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614793Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 614794Superfamily d.170.1: SRCR-like [56487] (2 families) (S)
  5. 614799Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
  6. 614800Protein Hepsin, N-terminal domain [103356] (1 species)
  7. 614801Species Human (Homo sapiens) [TaxId:9606] [103357] (3 PDB entries)
  8. 614804Domain d1o5el_: 1o5e L: [103886]
    Other proteins in same PDB: d1o5eh_
    complexed with 132; mutant

Details for d1o5el_

PDB Entry: 1o5e (more details), 1.75 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5el_ d.170.1.2 (L:) Hepsin, N-terminal domain {Human (Homo sapiens)}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

SCOP Domain Coordinates for d1o5el_:

Click to download the PDB-style file with coordinates for d1o5el_.
(The format of our PDB-style files is described here.)

Timeline for d1o5el_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o5eh_