![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.170: SRCR-like [56486] (2 superfamilies) unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta |
![]() | Superfamily d.170.1: SRCR-like [56487] (2 families) ![]() |
![]() | Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein) |
![]() | Protein Hepsin, N-terminal domain [103356] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103357] (3 PDB entries) |
![]() | Domain d1o5el_: 1o5e L: [103886] Other proteins in same PDB: d1o5eh_ |
PDB Entry: 1o5e (more details), 1.75 Å
SCOP Domain Sequences for d1o5el_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5el_ d.170.1.2 (L:) Hepsin, N-terminal domain {Human (Homo sapiens)} plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
Timeline for d1o5el_: