SCOP 1.69: Domain d1o5el_: 1o5e L:

Lineage for d1o5el_ (1o5e L:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.170: SRCR-like [56486] (2 superfamilies)
   unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta

4. Superfamily d.170.1: SRCR-like [56487] (2 families)

5. Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)

6. Protein Hepsin, N-terminal domain [103356] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103357] (3 PDB entries)

8. Domain d1o5el_: 1o5e L: [103886]
   Other proteins in same PDB: d1o5eh_

Details for d1o5el_

PDB Entry: 1o5e, 1.75 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5el_:

Sequence; same for both SEQRES and ATOM records:

>d1o5el_ d.170.1.2 (L:) Hepsin, N-terminal domain {Human (Homo sapiens)}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

Timeline for d1o5el_:

• d1o5el_ is new in SCOP 1.69
  
• d1o5el_ appears in SCOP 1.71
  
• d1o5el_ appears in the current release, SCOPe 2.08