Lineage for d1o5eh_ (1o5e H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056495Protein Hepsin, catalytic domain [101813] (1 species)
  7. 2056496Species Human (Homo sapiens) [TaxId:9606] [101814] (4 PDB entries)
    Uniprot P05981 163-417
  8. 2056500Domain d1o5eh_: 1o5e H: [103885]
    Other proteins in same PDB: d1o5el_
    complexed with 132

Details for d1o5eh_

PDB Entry: 1o5e (more details), 1.75 Å

PDB Description: Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA)
PDB Compounds: (H:) Serine protease hepsin

SCOPe Domain Sequences for d1o5eh_:

Sequence, based on SEQRES records: (download)

>d1o5eh_ b.47.1.2 (H:) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
aikthseasgmvtql

Sequence, based on observed residues (ATOM records): (download)

>d1o5eh_ b.47.1.2 (H:) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
aqasphglqlgvqavvyhggylpfnsndialvhlssplplteyiqpvclpaagqalvdgk
ictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagypeggidac
qgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifqaikthse
asgmvtql

SCOPe Domain Coordinates for d1o5eh_:

Click to download the PDB-style file with coordinates for d1o5eh_.
(The format of our PDB-style files is described here.)

Timeline for d1o5eh_: