Lineage for d1o5dt2 (1o5d T:107-205)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 454980Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 454981Family b.1.2.1: Fibronectin type III [49266] (24 proteins)
  6. 455036Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 455037Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 455045Domain d1o5dt2: 1o5d T:107-205 [103884]
    Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2

Details for d1o5dt2

PDB Entry: 1o5d (more details), 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5dt2:

Sequence, based on SEQRES records: (download)

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstds

Sequence, based on observed residues (ATOM records): (download)

>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds

SCOP Domain Coordinates for d1o5dt2:

Click to download the PDB-style file with coordinates for d1o5dt2.
(The format of our PDB-style files is described here.)

Timeline for d1o5dt2: