![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (24 proteins) |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries) |
![]() | Domain d1o5dt2: 1o5d T:107-205 [103884] Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2 |
PDB Entry: 1o5d (more details), 2.05 Å
SCOP Domain Sequences for d1o5dt2:
Sequence, based on SEQRES records: (download)
>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens)} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstds
>d1o5dt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens)} nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds
Timeline for d1o5dt2: