SCOPe 2.03: Domain d1o5dt1: 1o5d T:6-106

Lineage for d1o5dt1 (1o5d T:6-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
   Uniprot P13726 33-242

8. Domain d1o5dt1: 1o5d T:6-106 [103883]
   Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2
   complexed with cr9

Details for d1o5dt1

PDB Entry: 1o5d, 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1o5dt1:

Sequence; same for both SEQRES and ATOM records:

>d1o5dt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d1o5dt1:

• d1o5dt1 first appeared in SCOP 1.69
  
• d1o5dt1 appears in SCOPe 2.02
  
• d1o5dt1 appears in SCOPe 2.04
  
• d1o5dt1 appears in the current release, SCOPe 2.08