SCOP 1.69: Domain d1o5dt1: 1o5d T:6-106

Lineage for d1o5dt1 (1o5d T:6-106)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (24 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d1o5dt1: 1o5d T:6-106 [103883]
   Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2

Details for d1o5dt1

PDB Entry: 1o5d, 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5dt1:

Sequence; same for both SEQRES and ATOM records:

>d1o5dt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d1o5dt1:

• d1o5dt1 is new in SCOP 1.69
  
• d1o5dt1 appears in SCOP 1.71
  
• d1o5dt1 appears in the current release, SCOPe 2.08