Lineage for d1o5dl1 (1o5d L:47-86)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258104Protein Coagulation factor VIIa [57201] (1 species)
  7. 2258105Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2258154Domain d1o5dl1: 1o5d L:47-86 [103881]
    Other proteins in same PDB: d1o5dh_, d1o5dt1, d1o5dt2
    complexed with cr9

Details for d1o5dl1

PDB Entry: 1o5d (more details), 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1o5dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5dl1 g.3.11.1 (L:47-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
gdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d1o5dl1:

Click to download the PDB-style file with coordinates for d1o5dl1.
(The format of our PDB-style files is described here.)

Timeline for d1o5dl1: