Lineage for d1o5dl1 (1o5d L:47-86)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521739Superfamily g.3.11: EGF/Laminin [57196] (6 families) (S)
  5. 521740Family g.3.11.1: EGF-type module [57197] (21 proteins)
  6. 521749Protein Coagulation factor VIIa [57201] (1 species)
  7. 521750Species Human (Homo sapiens) [TaxId:9606] [57202] (15 PDB entries)
  8. 521756Domain d1o5dl1: 1o5d L:47-86 [103881]
    Other proteins in same PDB: d1o5dh_, d1o5dt1, d1o5dt2

Details for d1o5dl1

PDB Entry: 1o5d (more details), 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5dl1 g.3.11.1 (L:47-86) Coagulation factor VIIa {Human (Homo sapiens)}
gdqcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOP Domain Coordinates for d1o5dl1:

Click to download the PDB-style file with coordinates for d1o5dl1.
(The format of our PDB-style files is described here.)

Timeline for d1o5dl1:

521756
d1o5dl1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1o5dl2