SCOPe 2.01: Domain d1o5b.1: 1o5b A:,B:

Lineage for d1o5b.1 (1o5b A:,B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (52 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1o5b.1: 1o5b A:,B: [103878]
   complexed with cit, esi

Details for d1o5b.1

PDB Entry: 1o5b, 1.85 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d1o5b.1:

Sequence; same for both SEQRES and ATOM records:

>g1o5b.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqkXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdacqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirsht

Timeline for d1o5b.1:

• d1o5b.1 first appeared in SCOP 1.69
  
• d1o5b.1 appears in SCOP 1.75
  
• d1o5b.1 appears in SCOPe 2.02
  
• d1o5b.1 appears in the current release, SCOPe 2.08