SCOP 1.69: Domain d1o5b.1: 1o5b A:,B:

Lineage for d1o5b.1 (1o5b A:,B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (35 PDB entries)

8. Domain d1o5b.1: 1o5b A:,B: [103878]

Details for d1o5b.1

PDB Entry: 1o5b, 1.85 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5b.1:

Sequence; same for both SEQRES and ATOM records:

>g1o5b.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
lkfqcgqkXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdacqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirsht

Timeline for d1o5b.1:

• d1o5b.1 is new in SCOP 1.69
  
• d1o5b.1 appears in SCOP 1.71
  
• d1o5b.1 appears in the current release, SCOPe 2.08