Lineage for d1o5b.1 (1o5b A:,B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 466154Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 466155Species Human (Homo sapiens) [TaxId:9606] [50587] (35 PDB entries)
  8. 466176Domain d1o5b.1: 1o5b A:,B: [103878]

Details for d1o5b.1

PDB Entry: 1o5b (more details), 1.85 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)

SCOP Domain Sequences for d1o5b.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1o5b.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
lkfqcgqkXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdacqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirsht

SCOP Domain Coordinates for d1o5b.1:

Click to download the PDB-style file with coordinates for d1o5b.1.
(The format of our PDB-style files is described here.)

Timeline for d1o5b.1: