SCOPe 2.06: Domain d1ny8a1: 1ny8 A:1-89

Lineage for d1ny8a1 (1ny8 A:1-89)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.6: BolA-like [82657] (1 family)

5. Family d.52.6.1: BolA-like [82658] (3 proteins)
   Pfam PF01722

6. Protein Hypothetical protein YrbA [110929] (1 species)

7. Species Escherichia coli [TaxId:562] [110930] (1 PDB entry)
   Uniprot P43781

8. Domain d1ny8a1: 1ny8 A:1-89 [103876]
   Other proteins in same PDB: d1ny8a2
   Structural genomics target

Details for d1ny8a1

PDB Entry: 1ny8

PDB Description: solution structure of protein yrba from escherichia coli: northeast structural genomics consortium target er115

PDB Compounds: (A:) Protein yrbA

SCOPe Domain Sequences for d1ny8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ny8a1 d.52.6.1 (A:1-89) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]}
miedpmenneiqsvlmnalslqevhvsgdgshfqviavgelfdgmsrvkkqqtvygplme
yiadnrihavsikaytpaewardrklngf

Timeline for d1ny8a1:

• d1ny8a1 first appeared in SCOP 1.69, called d1ny8a_
  
• d1ny8a1 was called d1ny8a_ in SCOPe 2.05
  
• d1ny8a1 appears in SCOPe 2.07
  
• d1ny8a1 appears in the current release, SCOPe 2.08