Lineage for d1ny8a1 (1ny8 A:1-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947404Superfamily d.52.6: BolA-like [82657] (1 family) (S)
  5. 2947405Family d.52.6.1: BolA-like [82658] (3 proteins)
    Pfam PF01722
  6. 2947409Protein Hypothetical protein YrbA [110929] (1 species)
  7. 2947410Species Escherichia coli [TaxId:562] [110930] (1 PDB entry)
    Uniprot P43781
  8. 2947411Domain d1ny8a1: 1ny8 A:1-89 [103876]
    Other proteins in same PDB: d1ny8a2
    Structural genomics target

Details for d1ny8a1

PDB Entry: 1ny8 (more details)

PDB Description: solution structure of protein yrba from escherichia coli: northeast structural genomics consortium target er115
PDB Compounds: (A:) Protein yrbA

SCOPe Domain Sequences for d1ny8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny8a1 d.52.6.1 (A:1-89) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]}
miedpmenneiqsvlmnalslqevhvsgdgshfqviavgelfdgmsrvkkqqtvygplme
yiadnrihavsikaytpaewardrklngf

SCOPe Domain Coordinates for d1ny8a1:

Click to download the PDB-style file with coordinates for d1ny8a1.
(The format of our PDB-style files is described here.)

Timeline for d1ny8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ny8a2