Lineage for d1nx7a_ (1nx7 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510360Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 510361Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (2 families) (S)
  5. 510362Family d.120.1.1: Cytochrome b5 [55857] (4 proteins)
  6. 510363Protein Cytochrome b5 [55858] (3 species)
  7. 510364Species Cow (Bos taurus) [TaxId:9913] [55859] (16 PDB entries)
  8. 510375Domain d1nx7a_: 1nx7 A: [103875]

Details for d1nx7a_

PDB Entry: 1nx7 (more details)

PDB Description: solution structure of oxidized bovine microsomal cytochrome b5

SCOP Domain Sequences for d1nx7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nx7a_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus)}
avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedvg
hstdarelsktfiigelhpddr

SCOP Domain Coordinates for d1nx7a_:

Click to download the PDB-style file with coordinates for d1nx7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nx7a_: