Lineage for d1ntya2 (1nty A:1415-1535)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394382Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2394621Protein Triple functional domain protein TRIO [110264] (1 species)
  7. 2394622Species Human (Homo sapiens) [TaxId:9606] [110265] (2 PDB entries)
    Uniprot O75962 1231-1535
  8. 2394623Domain d1ntya2: 1nty A:1415-1535 [103874]
    Other proteins in same PDB: d1ntya1

Details for d1ntya2

PDB Entry: 1nty (more details), 1.7 Å

PDB Description: crystal structure of the first dh/ph domain of trio to 1.7 a
PDB Compounds: (A:) triple functional domain protein

SCOPe Domain Sequences for d1ntya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskyly
ksklftselgvtehvegdpckfalwvgrtptsdnkivlkassienkqdwikhireviqer
t

SCOPe Domain Coordinates for d1ntya2:

Click to download the PDB-style file with coordinates for d1ntya2.
(The format of our PDB-style files is described here.)

Timeline for d1ntya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ntya1