Lineage for d1ntya1 (1nty A:1231-1414)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445734Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 445735Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 445736Family a.87.1.1: DBL homology domain (DH-domain) [48066] (8 proteins)
    Pfam 00621
  6. 445777Protein Triple functional domain protein TRIO [109935] (1 species)
  7. 445778Species Human (Homo sapiens) [TaxId:9606] [109936] (1 PDB entry)
  8. 445779Domain d1ntya1: 1nty A:1231-1414 [103873]
    Other proteins in same PDB: d1ntya2

Details for d1ntya1

PDB Entry: 1nty (more details), 1.7 Å

PDB Description: crystal structure of the first dh/ph domain of trio to 1.7 a

SCOP Domain Sequences for d1ntya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens)}
arrkefimaeliqtekayvrdlrecmdtylwemtsgveeippgivnkeliifgnmqeiye
fhnniflkelekyeqlpedvghcfvtwadkfqmyvtycknkpdstqlilehagsyfdeiq
qrhglansissylikpvqritkyqlllkelltcceegkgeikdglevmlsvpkrandamh
lsml

SCOP Domain Coordinates for d1ntya1:

Click to download the PDB-style file with coordinates for d1ntya1.
(The format of our PDB-style files is described here.)

Timeline for d1ntya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ntya2