Lineage for d1nond_ (1non D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128488Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 2128489Species Bacillus caldolyticus [TaxId:1394] [110659] (4 PDB entries)
    Uniprot P41007
  8. 2128495Domain d1nond_: 1non D: [103871]

Details for d1nond_

PDB Entry: 1non (more details), 2.4 Å

PDB Description: PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus
PDB Compounds: (D:) PyrR bifunctional protein

SCOPe Domain Sequences for d1nond_:

Sequence, based on SEQRES records: (download)

>d1nond_ c.61.1.1 (D:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records): (download)

>d1nond_ c.61.1.1 (D:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
hrelpiradfvgknvptsrselivvelsevdgidqvsihek

SCOPe Domain Coordinates for d1nond_:

Click to download the PDB-style file with coordinates for d1nond_.
(The format of our PDB-style files is described here.)

Timeline for d1nond_: