SCOP 1.71: Domain d1nonc_: 1non C:

Lineage for d1nonc_ (1non C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (12 proteins)

6. Protein Pyrimidine operon regulator PyrR [109612] (4 species)
   bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities

7. Species Bacillus caldolyticus [TaxId:1394] [110659] (1 PDB entry)

8. Domain d1nonc_: 1non C: [103870]

Details for d1nonc_

PDB Entry: 1non, 2.4 Å

PDB Description: PyrR, the regulator of the pyrimidine biosynthetic operon in Bacillus caldolyticus

SCOP Domain Sequences for d1nonc_:

Sequence, based on SEQRES records:

>d1nonc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records):

>d1nonc_ c.61.1.1 (C:) Pyrimidine operon regulator PyrR {Bacillus caldolyticus}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
hrelpiradfvgknvptsrselivvelsevdgidqvsihek

Timeline for d1nonc_:

• d1nonc_ first appeared in SCOP 1.69
  
• d1nonc_ appears in SCOP 1.73
  
• d1nonc_ appears in the current release, SCOPe 2.08