Lineage for d1nkqa_ (1nkq A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515151Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 515152Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 515153Family d.177.1.1: FAH [56530] (5 proteins)
  6. 515189Protein Hypothetical protein Ynl168c [111272] (1 species)
  7. 515190Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111273] (1 PDB entry)
  8. 515191Domain d1nkqa_: 1nkq A: [103862]

Details for d1nkqa_

PDB Entry: 1nkq (more details), 2.2 Å

PDB Description: crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein

SCOP Domain Sequences for d1nkqa_:

Sequence, based on SEQRES records: (download)

>d1nkqa_ d.177.1.1 (A:) Hypothetical protein Ynl168c {Baker's yeast (Saccharomyces cerevisiae)}
synylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpans
tfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalald
ltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlr
qdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndniv
dmnfecenrpgpyefre

Sequence, based on observed residues (ATOM records): (download)

>d1nkqa_ d.177.1.1 (A:) Hypothetical protein Ynl168c {Baker's yeast (Saccharomyces cerevisiae)}
synylkaarkiicigrnyaahikelnnqpffflkptssivtplssspanstfnglnedgt
npgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdea
kkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlh
plhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrp
gpyefre

SCOP Domain Coordinates for d1nkqa_:

Click to download the PDB-style file with coordinates for d1nkqa_.
(The format of our PDB-style files is described here.)

Timeline for d1nkqa_: