Lineage for d1nkga2 (1nkg A:338-508)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459236Family b.18.1.25: Rhamnogalacturonase B, RhgB, C-terminal domain [110128] (1 protein)
  6. 459237Protein Rhamnogalacturonase B, RhgB, C-terminal domain [110129] (1 species)
  7. 459238Species Aspergillus aculeatus [TaxId:5053] [110130] (1 PDB entry)
  8. 459239Domain d1nkga2: 1nkg A:338-508 [103860]
    Other proteins in same PDB: d1nkga1, d1nkga3

Details for d1nkga2

PDB Entry: 1nkg (more details), 1.5 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus

SCOP Domain Sequences for d1nkga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkga2 b.18.1.25 (A:338-508) Rhamnogalacturonase B, RhgB, C-terminal domain {Aspergillus aculeatus }
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq

SCOP Domain Coordinates for d1nkga2:

Click to download the PDB-style file with coordinates for d1nkga2.
(The format of our PDB-style files is described here.)

Timeline for d1nkga2: