Lineage for d1nkga1 (1nkg A:251-337)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790480Family b.3.1.2: Rhamnogalacturonase B, RhgB, middle domain [110091] (1 protein)
  6. 790481Protein Rhamnogalacturonase B, RhgB, middle domain [110092] (1 species)
  7. 790482Species Aspergillus aculeatus [TaxId:5053] [110093] (1 PDB entry)
    Uniprot Q00019
  8. 790483Domain d1nkga1: 1nkg A:251-337 [103859]
    Other proteins in same PDB: d1nkga2, d1nkga3
    complexed with ca, so4

Details for d1nkga1

PDB Entry: 1nkg (more details), 1.5 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus
PDB Compounds: (A:) Rhamnogalacturonase B

SCOP Domain Sequences for d1nkga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]}
yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq
geyavatssvtvsagstttknisgsvk

SCOP Domain Coordinates for d1nkga1:

Click to download the PDB-style file with coordinates for d1nkga1.
(The format of our PDB-style files is described here.)

Timeline for d1nkga1: