![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
![]() | Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
![]() | Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
![]() | Protein Hypothetical protein Ymr087W [110654] (1 species) contains structural variations at both termini |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110655] (3 PDB entries) Uniprot Q04299 |
![]() | Domain d1njra_: 1njr A: [103858] complexed with xyl |
PDB Entry: 1njr (more details), 1.9 Å
SCOPe Domain Sequences for d1njra_:
Sequence, based on SEQRES records: (download)
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kmriilcdtnevvtnlwqesiphayiqndkylcihhghlqslmdsmrkgdaihhghsyai vspgnsygylgggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleektie crdgiryiihvptvvapsapifnpqnplktgfepvfnamwnalmhspkdidgliipglct gyagvppiiscksmafalrlymagdhiskelknvlimyylqypfepffpesckiecqklg idiemlksfnvekdaielliprri
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kmriilcdtnevvtnlwqesipkylcihhghlqslmdsmrkgdahsyaivspgnsygylg ggfdkalynyfggkpfetwfrnqlggryhtvgsatvvdlqrcleecrdgiryiihvptvv apsapifnpqnplktgfepvfnamwnalmhspkdidgliipglctgyagvppiiscksma falrlymagdhiskelknvlimyylqypfepffpesckiecqklgidiemlksfnvekda ielliprri
Timeline for d1njra_: