Lineage for d1n70a1 (1n70 A:41-193)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457981Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 458069Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 458288Species Rhodobacter sphaeroides [TaxId:1063] [110101] (3 PDB entries)
  8. 458291Domain d1n70a1: 1n70 A:41-193 [103856]

Details for d1n70a1

PDB Entry: 1n70 (more details), 1.6 Å

PDB Description: the crystal structure of nitrite reductase mutant his287ala from rhodobacter sphaeroides

SCOP Domain Sequences for d1n70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n70a1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgmagcimvlprdg

SCOP Domain Coordinates for d1n70a1:

Click to download the PDB-style file with coordinates for d1n70a1.
(The format of our PDB-style files is described here.)

Timeline for d1n70a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n70a2