Lineage for d1n70a1 (1n70 A:41-193)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (6 families) 
contains copper-binding site
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) Protein Nitrite reductase, NIR [49551] (5 species)
consists of two domains of this fold
Species Rhodobacter sphaeroides [TaxId:1063] [110101] (3 PDB entries) 
Domain d1n70a1: 1n70 A:41-193 [103856]
Details for d1n70a1
PDB Entry: 1n70 (more details), 1.6 Å
PDB Description: the crystal structure of nitrite reductase mutant his287ala from rhodobacter sphaeroides
SCOP Domain Sequences for d1n70a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n70a1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgmagcimvlprdg
SCOP Domain Coordinates for d1n70a1:
Click to download the PDB-style file with coordinates for d1n70a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n70a1:
- d1n70a1 is new in SCOP 1.69
- d1n70a1 appears in SCOP 1.71
- d1n70a1 appears in the current release, SCOPe 2.08
View in 3D
