Lineage for d1mzzc1 (1mzz C:2041-2193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381679Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2381690Domain d1mzzc1: 1mzz C:2041-2193 [103854]
    Other proteins in same PDB: d1mzza3, d1mzzb3, d1mzzc3
    complexed with cu; mutant

Details for d1mzzc1

PDB Entry: 1mzz (more details), 2 Å

PDB Description: crystal structure of mutant (m182t)of nitrite reductase
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzzc1 b.6.1.3 (C:2041-2193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgtagcimvlprdg

SCOPe Domain Coordinates for d1mzzc1:

Click to download the PDB-style file with coordinates for d1mzzc1.
(The format of our PDB-style files is described here.)

Timeline for d1mzzc1: