Lineage for d1mzzb2 (1mzz B:1194-1371)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2044087Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2044430Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2044446Domain d1mzzb2: 1mzz B:1194-1371 [103853]
    Other proteins in same PDB: d1mzza3, d1mzzb3, d1mzzc3
    complexed with cu; mutant

Details for d1mzzb2

PDB Entry: 1mzz (more details), 2 Å

PDB Description: crystal structure of mutant (m182t)of nitrite reductase
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzzb2 b.6.1.3 (B:1194-1371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn
gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw
firggtagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg

SCOPe Domain Coordinates for d1mzzb2:

Click to download the PDB-style file with coordinates for d1mzzb2.
(The format of our PDB-style files is described here.)

Timeline for d1mzzb2: