Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [419333] (8 PDB entries) Uniprot Q53239 |
Domain d1mzzb2: 1mzz B:1194-1371 [103853] Other proteins in same PDB: d1mzza1, d1mzza3, d1mzzb1, d1mzzb3, d1mzzc1, d1mzzc3 complexed with cu; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1mzz (more details), 2 Å
SCOPe Domain Sequences for d1mzzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzzb2 b.6.1.3 (B:1194-1371) Nitrite reductase, NIR, C-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]} lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw firggtagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg
Timeline for d1mzzb2: