![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries) Uniprot Q53239 |
![]() | Domain d1mzzb1: 1mzz B:1041-1193 [103852] Other proteins in same PDB: d1mzza2, d1mzza3, d1mzzb2, d1mzzb3, d1mzzc2, d1mzzc3 complexed with cu; mutant |
PDB Entry: 1mzz (more details), 2 Å
SCOPe Domain Sequences for d1mzzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzzb1 b.6.1.3 (B:1041-1193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]} lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra gafvyhcapggpmipwhvvsgtagcimvlprdg
Timeline for d1mzzb1: