Lineage for d1mzza2 (1mzz A:194-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771509Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. 2771718Species Rhodobacter sphaeroides [TaxId:1063] [419333] (8 PDB entries)
    Uniprot Q53239
  8. 2771720Domain d1mzza2: 1mzz A:194-371 [103851]
    Other proteins in same PDB: d1mzza1, d1mzza3, d1mzzb1, d1mzzb3, d1mzzc1, d1mzzc3
    complexed with cu; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1mzza2

PDB Entry: 1mzz (more details), 2 Å

PDB Description: crystal structure of mutant (m182t)of nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzza2 b.6.1.3 (A:194-371) Nitrite reductase, NIR, C-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn
gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw
firggtagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg

SCOPe Domain Coordinates for d1mzza2:

Click to download the PDB-style file with coordinates for d1mzza2.
(The format of our PDB-style files is described here.)

Timeline for d1mzza2: