SCOPe 2.03: Domain d1mzza1: 1mzz A:41-193

Lineage for d1mzza1 (1mzz A:41-193)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
   Uniprot Q53239

8. Domain d1mzza1: 1mzz A:41-193 [103850]
   complexed with cu; mutant

Details for d1mzza1

PDB Entry: 1mzz, 2 Å

PDB Description: crystal structure of mutant (m182t)of nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzza1:

Sequence; same for both SEQRES and ATOM records:

>d1mzza1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgtagcimvlprdg

Timeline for d1mzza1:

• d1mzza1 first appeared in SCOP 1.69
  
• d1mzza1 appears in SCOPe 2.02
  
• d1mzza1 appears in SCOPe 2.04
  
• d1mzza1 appears in the current release, SCOPe 2.08