Lineage for d1mzza1 (1mzz A:41-193)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367152Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2367387Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2367730Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
    Uniprot Q53239
  8. 2367737Domain d1mzza1: 1mzz A:41-193 [103850]
    Other proteins in same PDB: d1mzza3, d1mzzb3, d1mzzc3
    complexed with cu; mutant

Details for d1mzza1

PDB Entry: 1mzz (more details), 2 Å

PDB Description: Crystal Structure of Mutant (M182T)of Nitrite Reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzza1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgtagcimvlprdg

SCOPe Domain Coordinates for d1mzza1:

Click to download the PDB-style file with coordinates for d1mzza1.
(The format of our PDB-style files is described here.)

Timeline for d1mzza1: