Lineage for d1mzza1 (1mzz A:41-193)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)
  7. Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries)
    Uniprot Q53239
  8. Domain d1mzza1: 1mzz A:41-193 [103850]
    Other proteins in same PDB: d1mzza2, d1mzza3, d1mzzb2, d1mzzb3, d1mzzc2, d1mzzc3
    complexed with cu; mutant

Details for d1mzza1

PDB Entry: 1mzz (more details), 2 Å

PDB Description: Crystal Structure of Mutant (M182T)of Nitrite Reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mzza1 b.6.1.3 (A:41-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgtagcimvlprdg

SCOPe Domain Coordinates for d1mzza1 are not available.

Timeline for d1mzza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mzza2, d1mzza3
View in 3D
Domains from other chains:
(mouse over for more information)
d1mzzb1, d1mzzb2, d1mzzb3, d1mzzc1, d1mzzc2, d1mzzc3