![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (6 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [110101] (3 PDB entries) |
![]() | Domain d1mzya1: 1mzy A:41-193 [103848] |
PDB Entry: 1mzy (more details), 1.46 Å
SCOP Domain Sequences for d1mzya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides} lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra gafvyhcapggpmipwhvvsgmagcimvlprdg
Timeline for d1mzya1: