Lineage for d1mqoa_ (1mqo A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2602908Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2602921Species Bacillus cereus [TaxId:1396] [56284] (29 PDB entries)
    Uniprot P04190 31-257
  8. 2602926Domain d1mqoa_: 1mqo A: [103846]
    complexed with cd, cit

Details for d1mqoa_

PDB Entry: 1mqo (more details), 1.35 Å

PDB Description: Metallo-beta-lactamase BcII Cd substituted from Bacillus cereus at 1.35 angstroms resolution
PDB Compounds: (A:) beta-lactamase II

SCOPe Domain Sequences for d1mqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d1mqoa_:

Click to download the PDB-style file with coordinates for d1mqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1mqoa_: