SCOP 1.69: Domain d1mqoa_: 1mqo A:

Lineage for d1mqoa_ (1mqo A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)

6. Protein Zn metallo-beta-lactamase [56283] (7 species)

7. Species Bacillus cereus [TaxId:1396] [56284] (7 PDB entries)

8. Domain d1mqoa_: 1mqo A: [103846]

Details for d1mqoa_

PDB Entry: 1mqo, 1.35 Å

PDB Description: Metallo-beta-lactamase BcII Cd substituted from Bacillus cereus at 1.35 angstroms resolution

SCOP Domain Sequences for d1mqoa_:

Sequence; same for both SEQRES and ATOM records:

>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk

Timeline for d1mqoa_:

• d1mqoa_ is new in SCOP 1.69
  
• d1mqoa_ appears in SCOP 1.71
  
• d1mqoa_ appears in the current release, SCOPe 2.08