Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) |
Protein Zn metallo-beta-lactamase [56283] (7 species) |
Species Bacillus cereus [TaxId:1396] [56284] (7 PDB entries) |
Domain d1mqoa_: 1mqo A: [103846] |
PDB Entry: 1mqo (more details), 1.35 Å
SCOP Domain Sequences for d1mqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus} tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv newstsienvlkryrninavvpghgevgdkglllhtldllk
Timeline for d1mqoa_: