Lineage for d1j9ct1 (1j9c T:1-106)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935829Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 935830Species Human (Homo sapiens) [TaxId:9606] [49268] (12 PDB entries)
    Uniprot P13726 33-242
  8. 935850Domain d1j9ct1: 1j9c T:1-106 [103844]
    Other proteins in same PDB: d1j9ch_, d1j9cl1, d1j9cl2
    complexed with 0z6, ca, ful, glc, nag

Details for d1j9ct1

PDB Entry: 1j9c (more details), 2.9 Å

PDB Description: Crystal Structure of tissue factor-factor VIIa complex
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1j9ct1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j9ct1 b.1.2.1 (T:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOPe Domain Coordinates for d1j9ct1:

Click to download the PDB-style file with coordinates for d1j9ct1.
(The format of our PDB-style files is described here.)

Timeline for d1j9ct1: