Lineage for d1j3xa_ (1j3x A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535057Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 535058Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 535059Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 535071Protein High mobility group protein 2, HMG2 [109762] (1 species)
  7. 535072Species Pig (Sus scrofa) [TaxId:9823] [109763] (3 PDB entries)
  8. 535074Domain d1j3xa_: 1j3x A: [103840]
    domain A
    mutant

Details for d1j3xa_

PDB Entry: 1j3x (more details)

PDB Description: solution structure of the n-terminal domain of the hmgb2

SCOP Domain Sequences for d1j3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3xa_ a.21.1.1 (A:) High mobility group protein 2, HMG2 {Pig (Sus scrofa)}
mgkgdpnkprgkmssyaffvqtsreehkkkhpdssvnfaefskkcserwktmsakekskf
edmaksdkarydremkn

SCOP Domain Coordinates for d1j3xa_:

Click to download the PDB-style file with coordinates for d1j3xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3xa_: