SCOP 1.75: Domain d1j3sa_: 1j3s A:

Lineage for d1j3sa_ (1j3s A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109644] (1 PDB entry)
   Uniprot P99999

8. Domain d1j3sa_: 1j3s A: [103838]
   complexed with hec

Details for d1j3sa_

PDB Entry: 1j3s

PDB Description: solution structure of reduced recombinant human cytochrome c

PDB Compounds: (A:) cytochrome c

SCOP Domain Sequences for d1j3sa_:

Sequence; same for both SEQRES and ATOM records:

>d1j3sa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

Timeline for d1j3sa_:

• d1j3sa_ first appeared in SCOP 1.69
  
• d1j3sa_ appears in SCOP 1.73
  
• d1j3sa_ appears in SCOPe 2.01
  
• d1j3sa_ appears in the current release, SCOPe 2.08