Class a: All alpha proteins [46456] (258 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [109644] (1 PDB entry) |
Domain d1j3sa_: 1j3s A: [103838] complexed with hec |
PDB Entry: 1j3s (more details)
SCOP Domain Sequences for d1j3sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3sa_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]} gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktgqapgysytaanknkgiiwg edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne
Timeline for d1j3sa_: