![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.7: TT1751-like [103247] (1 family) ![]() contains a single copy of this fold decorated with additional structures; forms dimer |
![]() | Family d.129.7.1: TT1751-like [103248] (2 proteins) Pfam PF03625; DUF302 |
![]() | Protein Hypothetical protein TT1751 (TTHA1732) [111164] (1 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [111165] (1 PDB entry) Uniprot Q84BQ8 |
![]() | Domain d1j3mb_: 1j3m B: [103837] Structural genomics target complexed with so3 |
PDB Entry: 1j3m (more details), 2 Å
SCOPe Domain Sequences for d1j3mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3mb_ d.129.7.1 (B:) Hypothetical protein TT1751 (TTHA1732) {Thermus thermophilus HB8 [TaxId: 300852]} gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl sralsrl
Timeline for d1j3mb_: