SCOPe 2.08: Domain d1j3mb_: 1j3m B:

Lineage for d1j3mb_ (1j3m B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.7: TT1751-like [103247] (1 family)
   contains a single copy of this fold decorated with additional structures; forms dimer

5. Family d.129.7.1: TT1751-like [103248] (2 proteins)
   Pfam PF03625; DUF302

6. Protein Hypothetical protein TT1751 (TTHA1732) [111164] (1 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [111165] (1 PDB entry)
   Uniprot Q84BQ8

8. Domain d1j3mb_: 1j3m B: [103837]
   Structural genomics target
   complexed with so3

Details for d1j3mb_

PDB Entry: 1j3m, 2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1751 from Thermus thermophilus HB8

PDB Compounds: (B:) the conserved hypothetical protein TT1751

SCOPe Domain Sequences for d1j3mb_:

Sequence; same for both SEQRES and ATOM records:

>d1j3mb_ d.129.7.1 (B:) Hypothetical protein TT1751 (TTHA1732) {Thermus thermophilus HB8 [TaxId: 300852]}
gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
sralsrl

Timeline for d1j3mb_:

• d1j3mb_ first appeared in SCOP 1.69
  
• d1j3mb_ appears in SCOPe 2.07