Lineage for d1j3ma_ (1j3m A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511174Superfamily d.129.7: TT1751-like [103247] (1 family) (S)
    contains a single copy of this fold decorated with additional structures; forms dimer
  5. 511175Family d.129.7.1: TT1751-like [103248] (2 proteins)
    Pfam 03625; domain of unknown function DUF302
  6. 511176Protein Hypothetical protein TT1751 (TTHA1732) [111164] (1 species)
  7. 511177Species Thermus thermophilus HB8 [TaxId:300852] [111165] (1 PDB entry)
  8. 511178Domain d1j3ma_: 1j3m A: [103836]

Details for d1j3ma_

PDB Entry: 1j3m (more details), 2 Å

PDB Description: Crystal structure of the conserved hypothetical protein TT1751 from Thermus thermophilus HB8

SCOP Domain Sequences for d1j3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ma_ d.129.7.1 (A:) Hypothetical protein TT1751 (TTHA1732) {Thermus thermophilus HB8}
gmrktlkatlaearaqveaalkeegfgilteidvaatlkaklglekppylilgacnpnla
aralealpeiglllpcnvvlreaeegvevliqdpkemfrvlpeatqralapvaeeartrl
sralsrl

SCOP Domain Coordinates for d1j3ma_:

Click to download the PDB-style file with coordinates for d1j3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ma_: