Lineage for d1j3fa_ (1j3f A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717514Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
    Uniprot P02185
  8. 1717564Domain d1j3fa_: 1j3f A: [103835]
    complexed with cr, czm, po4

Details for d1j3fa_

PDB Entry: 1j3f (more details), 1.45 Å

PDB Description: Crystal Structure of an Artificial Metalloprotein:Cr(III)(3,3'-Me2-salophen)/apo-A71G Myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1j3fa_:

Sequence, based on SEQRES records: (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records): (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1j3fa_:

Click to download the PDB-style file with coordinates for d1j3fa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3fa_: