Lineage for d1j3fa_ (1j3f A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531626Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 531639Domain d1j3fa_: 1j3f A: [103835]
    complexed with cr, czm, po4; mutant

Details for d1j3fa_

PDB Entry: 1j3f (more details), 1.45 Å

PDB Description: crystal structure of an artificial metalloprotein:cr(iii)(3,3'-me2- salophen)/apo-a71g myoglobin

SCOP Domain Sequences for d1j3fa_:

Sequence, based on SEQRES records: (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Sequence, based on observed residues (ATOM records): (download)

>d1j3fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltglgailkkkghheaelkplaqshatkipikylefiseaiihvlhsrhpg
dfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1j3fa_:

Click to download the PDB-style file with coordinates for d1j3fa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3fa_: